PDB entry 2x8a

View 2x8a on RCSB PDB site
Description: human nuclear valosin containing protein like (nvl), c-terminal aaa-ATPase domain
Class: nuclear protein
Keywords: nuclear protein
Deposited on 2010-03-08, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2141
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear valosin-containing protein-like
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x8aa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x8aA (A:)
    smtvpnvtwadigaledireeltmailapvrnpdqfkalglvtpagvllagppgcgktll
    akavanesglnfisvkgpellnmyvgeseravrqvfqraknsapcviffdevdalcprrs
    dretgasvrvvnqlltemdglearqqvfimaatnrpdiidpailrpgrldktlfvglppp
    adrlailktitkngtkppldadvnleaiagdlrcdcytgadlsalvreasicalrqemar
    qksgnekgelkvshkhfeeafkkvrssiskkdqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x8aA (A:)
    igaledireeltmailapvrnpdqfkalglvtpagvllagppgcgktllakavanesgln
    fisvkgpellnmyvgeseravrqvfqraknsapcviffdevdalcpsvrvvnqlltemdg
    learqqvfimaatnrpdiidpailrpgrldktlfvglpppadrlailktitkngtkppld
    advnleaiagdlrcdcytgadlsalvreasicalrqemlkvshkhfeeafkkvrssi