PDB entry 2x89

View 2x89 on RCSB PDB site
Description: Structure of the Beta2_microglobulin involved in amyloidogenesis
Class: immune system
Keywords: immune system
Deposited on 2010-03-07, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.23962
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X89 (0-127)
    Domains in SCOPe 2.07: d2x89a1, d2x89a2
  • Chain 'B':
    Compound: antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X89 (0-127)
    Domains in SCOPe 2.07: d2x89b1, d2x89b2
  • Chain 'C':
    Compound: antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X89 (0-127)
    Domains in SCOPe 2.07: d2x89c1, d2x89c2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2x89d1, d2x89d2
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2x89e1, d2x89e2
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2x89f1, d2x89f2
  • Chain 'G':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2x89g1, d2x89g2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x89A (A:)
    qvqlqesgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityy
    adsvkgrftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgq
    gtqvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x89B (B:)
    qvqlqesgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityy
    adsvkgrftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgq
    gtqvtvss
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x89C (C:)
    qvqlqesgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityy
    adsvkgrftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgq
    gtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x89D (D:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x89D (D:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2x89E (E:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x89E (E:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2x89F (F:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x89F (F:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2x89G (G:)
    miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
    yyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x89G (G:)
    miqvysrhpgksnflncyvsgfhpsdievdllkngeriekvehsdlsfwsfyllyyteft
    ptekdeyacrvnhvtlsqpkivkwdr