PDB entry 2x86

View 2x86 on RCSB PDB site
Description: agme bound to ADP-b-mannose
Class: isomerase
Keywords: lipopolysaccharide biosynthesis, carbohydrate metabolism, isomerase, stress response
Deposited on 2010-03-06, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.25321
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86a_
  • Chain 'B':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86b_
  • Chain 'C':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86c_
  • Chain 'D':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86d_
  • Chain 'E':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86e_
  • Chain 'F':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86f_
  • Chain 'G':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86g_
  • Chain 'H':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86h_
  • Chain 'I':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86i_
  • Chain 'J':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86j_
  • Chain 'K':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86k_
  • Chain 'L':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86l_
  • Chain 'M':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86m_
  • Chain 'N':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86n_
  • Chain 'O':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86o_
  • Chain 'P':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86p_
  • Chain 'Q':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86q_
  • Chain 'R':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86r_
  • Chain 'S':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86s_
  • Chain 'T':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X86
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.06: d2x86t_
  • Heterogens: NAP, ADP, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x86A (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86A (A:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x86B (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86B (B:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x86C (C:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86C (C:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x86D (D:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86D (D:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2x86E (E:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86E (E:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2x86F (F:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86F (F:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2x86G (G:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86G (G:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2x86H (H:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86H (H:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2x86I (I:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86I (I:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2x86J (J:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86J (J:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2x86K (K:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86K (K:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2x86L (L:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86L (L:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2x86M (M:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86M (M:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2x86N (N:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86N (N:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2x86O (O:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86O (O:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2x86P (P:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86P (P:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2x86Q (Q:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86Q (Q:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2x86R (R:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86R (R:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2x86S (S:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86S (S:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2x86T (T:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x86T (T:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln