PDB entry 2x81

View 2x81 on RCSB PDB site
Description: structure of aurora a in complex with mln8054
Class: transferase
Keywords: transferase, drug-resistance, cell cycle, cytoskeleton
Deposited on 2010-03-05, released 2010-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.247
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2x81a_
  • Heterogens: ZZL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x81A (A:)
    gamgskrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyite
    lanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardl
    isrllkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x81A (A:)
    qwaledfeigrplgfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqshlr
    hpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychs
    krvihrdikpenlllgsagelkiagtldylppemiegrmhdekvdlwslgvlcyeflvgk
    ppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitan
    ss