PDB entry 2x7m

View 2x7m on RCSB PDB site
Description: crystal structure of archaemetzincin (amza) from methanopyrus kandleri at 1.5 a resolution
Deposited on 2010-03-01, released 2010-06-09
The last revision was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.178
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: archaemetzincin
    Species: METHANOPYRUS KANDLERI [TaxId:190192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TXW1 (20-End)
      • expression tag (13-19)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2x7mA (A:)
    mgsshhhhhhssglvprgshmklclvafdgripmlssivdrfeehvseylgevkvkkkra
    klpehayskvrgqylaralldtlrgmkgeydrvlgltsedlyapglnfvfgqarcpgrea
    vvsvarlldpdpelylervvkelthelghtfglghcpdrncvmsfsssllevdrkspnfc
    rrctellqrnlkrgg
    

    Sequence, based on observed residues (ATOM records):
    >2x7mA (A:)
    lvprgshmklclvafdgripmlssivdrfeehvseylgevkvkkkraklpehayskvrgq
    ylaralldtlrgmkgeydrvlgltsedlyapglnfvfgqarcpgreavvsvarlldpdpe
    lylervvkelthelghtfglghcpdrncvmsfsssllevdrkspnfcrrctellqrnlkr