PDB entry 2x7k

View 2x7k on RCSB PDB site
Description: The crystal structure of PPIL1 in complex with cyclosporine A suggests a binding mode for SKIP
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, isomerase-cyclosporin complex, cyclosporin a, immunosuppressant
Deposited on 2010-03-01, released 2010-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase-like 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2x7ka_
  • Chain 'B':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: CD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2x7kA (A:)
maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf
miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq
wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

    Sequence, based on observed residues (ATOM records): (download) 
    >2x7kA (A:)
aippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdfmi
qggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptqwl
dgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

  • Chain 'B':
    No sequence available.