PDB entry 2x6t

View 2x6t on RCSB PDB site
Description: agme bound to ADP-b-mannose
Class: isomerase
Keywords: isomerase, carbohydrate metabolism, stress response
Deposited on 2010-02-21, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.19032
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6ta_
  • Chain 'B':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6tb_
  • Chain 'C':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6tc_
  • Chain 'D':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6td_
  • Chain 'E':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6te_
  • Chain 'F':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6tf_
  • Chain 'G':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6tg_
  • Chain 'H':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6th_
  • Chain 'I':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6ti_
  • Chain 'J':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6T
      • engineered mutation (186)
    • Uniprot P67911 (47-End)
    Domains in SCOPe 2.07: d2x6tj_
  • Heterogens: NAP, GOL, ADP, BMA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x6tA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tA (A:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x6tB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tB (B:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x6tC (C:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tC (C:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x6tD (D:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tD (D:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2x6tE (E:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tE (E:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2x6tF (F:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tF (F:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2x6tG (G:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tG (G:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawlnr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2x6tH (H:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tH (H:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2x6tI (I:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tI (I:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2x6tJ (J:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtgggsgiegrmiivtggagfigs
    nivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqimageefgdveaif
    hegacssttewdgkymmdnnyqyskellhyclereipflyassaatyggrtsdfiesrey
    ekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgsmasvafhlntqln
    ngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatlay
    hkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvteymawlnrda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6tJ (J:)
    miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
    mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
    ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
    masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
    esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
    eymawln