PDB entry 2x6o

View 2x6o on RCSB PDB site
Description: Tet Repressor class D in complex with 7-chlor-2-cyano-iso- tetracycline
Class: transcription
Keywords: transcription, transcription regulation, antibiotic resistance
Deposited on 2010-02-18, released 2011-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21954
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-206)
      • expression tag (0)
    Domains in SCOPe 2.06: d2x6oa1, d2x6oa2, d2x6oa3
  • Heterogens: 2TC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x6oA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6oA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtlppllrealqimdsddgeqaflhglesli
    rgfevqltallqiv