PDB entry 2x6m

View 2x6m on RCSB PDB site
Description: Structure of a single domain camelid antibody fragment in complex with a C-terminal peptide of alpha-synuclein
Class: immune system
Keywords: immune system, parkinson's disease, alzheimer disease amyloid, nanobody, affinity tag
Deposited on 2010-02-18, released 2010-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain variable domain from dromedary
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6M (0-125)
    Domains in SCOPe 2.08: d2x6ma_
  • Chain 'B':
    Compound: alpha-synuclein peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x6mA (A:)
    gqlvesgggsvqaggslrlscaasgidsssycmgwfrqrpgkeregvaringlggvktay
    adsvkdrftisrdnaentvylqmnslkpedtaiyycaakfspgycggswsnfgywgqgtq
    vtvssh
    

  • Chain 'B':
    No sequence available.