PDB entry 2x6d

View 2x6d on RCSB PDB site
Description: aurora-a bound to an inhibitor
Class: transferase
Keywords: transferase, mitosis
Deposited on 2010-02-17, released 2010-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2197
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2x6da_
  • Heterogens: SO4, X6D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x6dA (A:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6dA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqleehqlrreveiqshlr
    hpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychs
    krvihrdikpenlllgsagelkiadfgwsvhapssrcgtldylppemiegrmhdekvdlw
    slgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpm
    lrevlehpwitanss