PDB entry 2x62

View 2x62 on RCSB PDB site
Description: crystal structure of the sialyltransferase cst-II y81f in complex with cmp
Class: transferase
Keywords: glycosyltransferase, gta, transferase
Deposited on 2010-02-14, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17939
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-2,3-/2,8-sialyltransferase
    Species: CAMPYLOBACTER JEJUNI [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAK3 (Start-258)
      • engineered mutation (52)
      • engineered mutation (80)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d2x62a_
  • Chain 'B':
    Compound: alpha-2,3-/2,8-sialyltransferase
    Species: CAMPYLOBACTER JEJUNI [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAK3 (0-258)
      • engineered mutation (52)
      • engineered mutation (80)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d2x62b_
  • Heterogens: EDO, CH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x62A (A:)
    mkkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyy
    tlkhliqnqeyetelimcsnfnqahlenenfvktfydyfpdahlgydffkqlkdfnayfk
    fheiyfnqritsgvymcavaialgykeiylsgidfyqngssyafdtkqknllklapnfkn
    dnshyighskntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnyt
    kdilipsseaygkfsknin
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x62A (A:)
    kkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyyt
    lkhliqnqeyetelimcsnfnqahlenenfvktfydyfpdahlgydffkqlkdfnayfkf
    heiyfnqritsgvymcavaialgykeiylsgidfyqssyafdtkqknllklapnfkyigh
    skntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnytkdilipss
    eaygkfsknin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x62B (B:)
    mkkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyy
    tlkhliqnqeyetelimcsnfnqahlenenfvktfydyfpdahlgydffkqlkdfnayfk
    fheiyfnqritsgvymcavaialgykeiylsgidfyqngssyafdtkqknllklapnfkn
    dnshyighskntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnyt
    kdilipsseaygkfsknin
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x62B (B:)
    mkkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyy
    tlkhliqnqeyetelimcsnfnqahlenenfvktfydyfpdahlgydffkqlkdfnayfk
    fheiyfnqritsgvymcavaialgykeiylsgidfyqsyafdtkqknllklapnfkndns
    hyighskntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnytkdi
    lipsseaygkfsknin