PDB entry 2x5d

View 2x5d on RCSB PDB site
Description: Crystal Structure of a probable aminotransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: transferase
Deposited on 2010-02-08, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.21753
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable aminotransferase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x5da_
  • Chain 'B':
    Compound: probable aminotransferase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x5db_
  • Chain 'C':
    Compound: probable aminotransferase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x5dc_
  • Chain 'D':
    Compound: probable aminotransferase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x5dd_
  • Heterogens: PLP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x5dA (A:)
    gmaesrparrfaridrlppyvfnitaelkmaarrrgediidlsmgnpdgptpphiveklc
    tvaqredthgystsrgiprlrraishwyrdrydvqidpeseaivtigskeglahlmlatl
    dhgdtilvpnpsypihiygaviagaqvrsvplvpgidffnelerairesipkprmmilgf
    psnptaqcveldffervvalakqydvmvvhdlayadivydgwkapsimqvpgakdiavef
    ftlsksynmagwrigfmvgnpelvsalariksyhdygtftplqvaaiaalegdqqcvrdi
    arqyqqrrdvlvkglreagwmvenpkasmyvwakipepyahlgslefakkllqdakvsvs
    pgigfgdygddhvrfalienrdrlrqavrgikamfradgllspqrkvdslae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5dA (A:)
    vfnitaelkmaarrrgediidlsmgnpdgptpphiveklctvatsrgiprlrraishwyr
    drydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiygaviagaqvrs
    vplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervvalakqydvmvv
    hdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgnpelvsalar
    iksyhdygtftplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagwmvenpkasm
    yvwakipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalienrdrlrqavr
    gikamfradgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x5dB (B:)
    gmaesrparrfaridrlppyvfnitaelkmaarrrgediidlsmgnpdgptpphiveklc
    tvaqredthgystsrgiprlrraishwyrdrydvqidpeseaivtigskeglahlmlatl
    dhgdtilvpnpsypihiygaviagaqvrsvplvpgidffnelerairesipkprmmilgf
    psnptaqcveldffervvalakqydvmvvhdlayadivydgwkapsimqvpgakdiavef
    ftlsksynmagwrigfmvgnpelvsalariksyhdygtftplqvaaiaalegdqqcvrdi
    arqyqqrrdvlvkglreagwmvenpkasmyvwakipepyahlgslefakkllqdakvsvs
    pgigfgdygddhvrfalienrdrlrqavrgikamfradgllspqrkvdslae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5dB (B:)
    vfnitaelkmaarrrgediidlsmgnpdgptpphiveklctvaqsrgiprlrraishwyr
    drydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiygaviagaqvrs
    vplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervvalakqydvmvv
    hdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgnpelvsalar
    iksyhdyplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagwmvenpkasmyvwa
    kipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalienrdrlrqavrgika
    mfradgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x5dC (C:)
    gmaesrparrfaridrlppyvfnitaelkmaarrrgediidlsmgnpdgptpphiveklc
    tvaqredthgystsrgiprlrraishwyrdrydvqidpeseaivtigskeglahlmlatl
    dhgdtilvpnpsypihiygaviagaqvrsvplvpgidffnelerairesipkprmmilgf
    psnptaqcveldffervvalakqydvmvvhdlayadivydgwkapsimqvpgakdiavef
    ftlsksynmagwrigfmvgnpelvsalariksyhdygtftplqvaaiaalegdqqcvrdi
    arqyqqrrdvlvkglreagwmvenpkasmyvwakipepyahlgslefakkllqdakvsvs
    pgigfgdygddhvrfalienrdrlrqavrgikamfradgllspqrkvdslae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5dC (C:)
    fnitaelkmaarrrgediidlsmgnpdgptpphiveklctvaqrsrgiprlrraishwyr
    drydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiygaviagaqvrs
    vplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervvalakqydvmvv
    hdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgnpelvsalar
    iksyhdygtftplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagwmvenpkasm
    yvwakipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalienrdrlrqavr
    gikamfradgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x5dD (D:)
    gmaesrparrfaridrlppyvfnitaelkmaarrrgediidlsmgnpdgptpphiveklc
    tvaqredthgystsrgiprlrraishwyrdrydvqidpeseaivtigskeglahlmlatl
    dhgdtilvpnpsypihiygaviagaqvrsvplvpgidffnelerairesipkprmmilgf
    psnptaqcveldffervvalakqydvmvvhdlayadivydgwkapsimqvpgakdiavef
    ftlsksynmagwrigfmvgnpelvsalariksyhdygtftplqvaaiaalegdqqcvrdi
    arqyqqrrdvlvkglreagwmvenpkasmyvwakipepyahlgslefakkllqdakvsvs
    pgigfgdygddhvrfalienrdrlrqavrgikamfradgllspqrkvdslae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x5dD (D:)
    vfnitaelkmaarrrgediidlsmgnpdgptpphiveklctvaqredthgystsrgiprl
    rraishwyrdrydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiyga
    viagaqvrsvplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervval
    akqydvmvvhdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgn
    pelvsalariksyhdygtftplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagw
    mvenpkasmyvwakipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalien
    rdrlrqavrgikamfradgl