PDB entry 2x51

View 2x51 on RCSB PDB site
Description: m6 delta insert1
Class: motor protein/signaling protein
Keywords: motor protein-signaling protein complex, endocytosis, protein transport, calmodulin-binding, transport, actin-binding, golgi apparatus
Deposited on 2010-02-04, released 2011-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-VI
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29122 (Start-788)
      • engineered mutation (520)
      • engineered mutation (545-546)
      • engineered mutation (687)
      • engineered mutation (694-695)
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x51b_
  • Heterogens: GOL, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x51B (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x51B (B:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvtmmtsk