PDB entry 2x4d

View 2x4d on RCSB PDB site
Description: crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-01-29, released 2010-03-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.229
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholysine phosphohistidine inorganic pyrophosphate phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X4D (0-0)
      • see remark 999 (94)
      • engineered mutation (160-161)
    • Uniprot Q9H008 (1-End)
    Domains in SCOPe 2.02: d2x4da_
  • Chain 'B':
    Compound: phospholysine phosphohistidine inorganic pyrophosphate phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X4D
      • see remark 999 (94)
      • engineered mutation (160-161)
    • Uniprot Q9H008
    Domains in SCOPe 2.02: d2x4db_
  • Heterogens: POP, MG, EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x4dA (A:)
    smapwgkrlagvrgvlldisgvlydsgagggtaiagsveavarlkrsrlkvrfctnesaa
    sraelvgqlqrlgfdiseqevtapapaacqilkerglrpyllihdgvrsefdqidtsnpn
    cvviadagesfsyqnmnnafqvlmelekpvlislgkgryyaatsglmldvgpymkaleya
    cgikaevvgkpspeffksalqaigveahqavmigddivgdvggaqrcgmralqvrtgkfr
    psdehhpevkadgyvdnlaeavdlllqhadk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x4dA (A:)
    smapwgkrlagvrgvlldisgvlydsgagggtaiagsveavarlkrsrlkvrfctnesaa
    sraelvgqlqrlgfdiseqevtapapaacqilkerglrpyllihdgvrsefdqidtsnpn
    cvviadagesfsyqnmnnafqvlmelekpvlislgkgryyaatsglmldvgpymkaleya
    cgikaevvgkpspeffksalqaigveahqavmigddivgdvggaqrcgmralqvrtgkfr
    psdehhpevkadgyvdnlaeavdlllqhad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x4dB (B:)
    smapwgkrlagvrgvlldisgvlydsgagggtaiagsveavarlkrsrlkvrfctnesaa
    sraelvgqlqrlgfdiseqevtapapaacqilkerglrpyllihdgvrsefdqidtsnpn
    cvviadagesfsyqnmnnafqvlmelekpvlislgkgryyaatsglmldvgpymkaleya
    cgikaevvgkpspeffksalqaigveahqavmigddivgdvggaqrcgmralqvrtgkfr
    psdehhpevkadgyvdnlaeavdlllqhadk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x4dB (B:)
    lldisgvlydsggtaiagsveavfctnesaasraelvgqltapapaacqilkerglrpyl
    lihdgvrsefdnpncvviadagesfsyqnmnnafqvlmelekpvlislgkgryyaaglml
    dvgpymkaleyacgikaevvgkpspeffksalqaigveahqavmigddivgdvggaqrcg
    mralqvrtgkfrpsdehhpevkadgyvdnlaea