PDB entry 2x49

View 2x49 on RCSB PDB site
Description: crystal structure of the c-terminal domain of inva
Deposited on 2010-01-28, released 2010-03-31
The last revision was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19346
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invasion protein inva
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X49 (0-3)
    • Uniprot P0A1I3 (4-332)
  • Heterogens: HG, CA, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2x49A (A:)
    gshmtetvplillvpksrredlekaqlaerlrsqffidygvrlpevllrdgeglddnsiv
    llineirveqftvyfdlmrvvnysdevvsfginptihqqgssqyfwvtheegeklrelgy
    vlrnaldelyhclavtlarnvneyfgiqetkhmldqleakfpdllkevlrhatvqrisev
    lqrllservsvrnmklimealalwaprekdvinlvehirgamaryichkfanggelravm
    vsaevedvirkgirqtsgstflsldpeasanlmdlitlklddlliahkdlvlltsvdvrr
    fikkmiegrfpdlevlsfgeiadsksvnvikti