PDB entry 2x46

View 2x46 on RCSB PDB site
Description: crystal structure of semet arg r 1
Deposited on 2010-01-28, released 2011-02-09
The last revision was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.13639
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allergen arg r 1
    Species: ARGAS REFLEXUS [TaxId:34604]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5GQ85 (1-143)
      • expression tag (0)
      • engineered mutation (70)
  • Heterogens: TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2x46A (A:)
    mddcsgktdawtsikgpktggywlkqttktgenectyvkgtdfkentktatytygykdas
    gkltkttgtamakgsdivvgsdtstviytdgktcdvvkhgghtelwvhssktsggynncc
    dkkftetrgstpanevykkcpgmp