PDB entry 2x41

View 2x41 on RCSB PDB site
Description: structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose
Class: hydrolase
Keywords: hydrolase, tim barrel fold, fibronectin type III fold
Deposited on 2010-01-28, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1889
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: THERMOTOGA NEAPOLITANA [TaxId:309803]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x41a1, d2x41a2, d2x41a3
  • Heterogens: BR, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x41A (A:)
    mekvneilsqltleekvklvvgvglpglfgnphsrvagaagethpvprvglpafvladgp
    aglrinptrendentyyttafpveimlastwnrelleevgkamgeevreygvdvllapam
    nihrnplcgrnfeyysedpvlsgemassfvkgvqsqgvgacikhfvannqetnrmvvdti
    vseralreiylrgfeiavkkskpwsvmsaynklngkycsqnewllkkvlreewgfegfvm
    sdwyagdnpveqlkagndlimpgkayqvnterrdeieeimealkegklseevldecvrni
    lkvlvnapsfknyrysnkpdlekhakvayeagaegvvllrneealplsenskialfgtgq
    ietikggtgsgdthpryaisilegikerglnfdeelaktyedyikkmreteeykprrdsw
    gtiikpklpenflsekeihklakkndvavivisrisgegydrkpvkgdfylsddetdlik
    tvsrefheqgkkvivllnigspvevvswrdlvdgillvwqagqetgrivadvltgrinps
    gklpttfprdysdvpswtfpgepkdnpqkvvyeediyvgyryydtfgvepayefgyglsy
    ttfeysdlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhktr
    llnpgeseevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrfk
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x41A (A:)
    ekvneilsqltleekvklvvgvglpglfgnphsrvagaagethpvprvglpafvladgpa
    glrinptrendentyyttafpveimlastwnrelleevgkamgeevreygvdvllapamn
    ihrnplcgrnfeyysedpvlsgemassfvkgvqsqgvgacikhfvannqetnrmvvdtiv
    seralreiylrgfeiavkkskpwsvmsaynklngkycsqnewllkkvlreewgfegfvms
    dwyagdnpveqlkagndlimpgkayqvnterrdeieeimealkegklseevldecvrnil
    kvlvnapsfknyrysnkpdlekhakvayeagaegvvllrneealplsenskialfgtgqi
    etikggtgsgdthpryaisilegikerglnfdeelaktyedyikkmreteeykprriikp
    klpenflsekeihklakkndvavivisrisgegydrkpvkgdfylsddetdliktvsref
    heqgkkvivllnigspvevvswrdlvdgillvwqagqetgrivadvltgrinpsgklptt
    fprdysdvpswtfpgepkdnpqkvvyeediyvgyryydtfgvepayefgyglsyttfeys
    dlnvsfdgetlrvqyrientggragkevsqvyikapkgkidkpfqelkafhktrllnpge
    seevvleipvrdlasfngeewvveageyevrvgassrniklkgtfsvgeerrfkp