PDB entry 2x3w

View 2x3w on RCSB PDB site
Description: structure of mouse syndapin I (crystal form 2)
Class: endocytosis
Keywords: endocytosis, n-wasp, dynamin, pacsin I, transferase
Deposited on 2010-01-28, released 2010-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.22335
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c and casein kinase substrate in neurons protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: protein kinase c and casein kinase substrate in neurons protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: protein kinase c and casein kinase substrate in neurons protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: protein kinase c and casein kinase substrate in neurons protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x3wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x3wD (D:)
    akgvrvralydydgqeqdelsfkagdeltklgeedeqgwcrgrldsgqlglypanyveai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x3wD (D:)
    vrvralydydgqeqdelsfkagdeltklgeedeqgwcrgrldsgqlglypanyvea