PDB entry 2x3f

View 2x3f on RCSB PDB site
Description: crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase.
Class: ligase
Keywords: ligase, ATP-binding, nucleotide-binding, pantothenate biosynthesis
Deposited on 2010-01-24, released 2010-07-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2021
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: panthothenate synthetase
    Species: Staphylococcus aureus subsp. aureus [TaxId:282458]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x3fa_
  • Chain 'B':
    Compound: panthothenate synthetase
    Species: Staphylococcus aureus subsp. aureus [TaxId:282458]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X3F
    • Uniprot Q6GDK5 (2-End)
    Domains in SCOPe 2.01: d2x3fb_
  • Heterogens: APC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x3fA (A:)
    gamtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditvvsvfv
    nplqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvle
    gakrpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivr
    eadglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidkvtqyleshisg
    rieevavysypqlveqheitgrifislavkfskarlidniiigae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x3fA (A:)
    tklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditvvsvfvnpl
    qfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlegak
    rpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivread
    glakssrnvylteqerqeavhlskslllaqalyqdgerqskviidkvtqyleshisgrie
    evavysypqlveqheitgrifislavkfskarlidniiiga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x3fB (B:)
    gamtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditvvsvfv
    nplqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvle
    gakrpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivr
    eadglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidkvtqyleshisg
    rieevavysypqlveqheitgrifislavkfskarlidniiigae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x3fB (B:)
    mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditvvsvfvnp
    lqfgpnedfayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlegak
    rpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivread
    glakssrnvylteqerqeavhlskslllaqalyqdgerqskviidkvtqyleshisgrie
    evavysypqlveqheitgrifislavkfskarlidniiiga