PDB entry 2x2w

View 2x2w on RCSB PDB site
Description: Acetylglutamate kinase from Escherichia coli bound to its product N- acetyl-L-glutamyl-5-phosphate
Class: transferase
Keywords: arginine biosynthesis, transferase, ATP-binding, nucleotide-binding, amino-acid biosynthesis, amino acid kinase family
Deposited on 2010-01-18, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x2wa_
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x2wb_
  • Heterogens: X2W, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x2wA (A:)
    mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
    kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
    hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
    dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
    eqlpalfngmpmgtrila
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x2wB (B:)
    mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
    kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
    hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
    dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
    eqlpalfngmpmgtrila