PDB entry 2x2h

View 2x2h on RCSB PDB site
Description: crystal structure of the gracilariopsis lemaneiformis alpha-1,4- glucan lyase
Deposited on 2010-01-13, released 2011-01-19
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1,4-glucan lyase isozyme 1
    Species: GRACILARIOPSIS LEMANEIFORMIS [TaxId:2782]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: alpha-1,4-glucan lyase isozyme 1
    Species: GRACILARIOPSIS LEMANEIFORMIS [TaxId:2782]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: alpha-1,4-glucan lyase isozyme 1
    Species: GRACILARIOPSIS LEMANEIFORMIS [TaxId:2782]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: alpha-1,4-glucan lyase isozyme 1
    Species: GRACILARIOPSIS LEMANEIFORMIS [TaxId:2782]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, ACT, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2x2hA (A:)
    gstdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsi
    tvqhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtft
    segfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygn
    aiasvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpp
    hhdgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqed
    laymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqg
    vfgtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwta
    nrvgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsl
    tgtdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvw
    qdmtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepm
    vtqrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsn
    yiqmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnh
    ydrwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaas
    mynndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkp
    legamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfpl
    gnnradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvr
    vrgaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlp
    davitit
    

    Sequence, based on observed residues (ATOM records):
    >2x2hA (A:)
    tdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsitv
    qhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtftse
    gfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygnai
    asvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpphh
    dgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqedla
    ymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqgvf
    gtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwtanr
    vgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsltg
    tdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvwqd
    mtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepmvt
    qrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsnyi
    qmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnhyd
    rwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaasmy
    nndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkple
    gamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfplgn
    nradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvrvr
    gaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlpda
    vitit
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2x2hB (B:)
    gstdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsi
    tvqhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtft
    segfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygn
    aiasvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpp
    hhdgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqed
    laymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqg
    vfgtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwta
    nrvgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsl
    tgtdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvw
    qdmtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepm
    vtqrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsn
    yiqmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnh
    ydrwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaas
    mynndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkp
    legamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfpl
    gnnradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvr
    vrgaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlp
    davitit
    

    Sequence, based on observed residues (ATOM records):
    >2x2hB (B:)
    tdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsitv
    qhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtftse
    gfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygnai
    asvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpphh
    dgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqedla
    ymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqgvf
    gtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwtanr
    vgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsltg
    tdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvwqd
    mtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepmvt
    qrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsnyi
    qmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnhyd
    rwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaasmy
    nndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkple
    gamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfplgn
    nradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvrvr
    gaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlpda
    vitit
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2x2hC (C:)
    gstdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsi
    tvqhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtft
    segfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygn
    aiasvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpp
    hhdgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqed
    laymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqg
    vfgtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwta
    nrvgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsl
    tgtdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvw
    qdmtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepm
    vtqrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsn
    yiqmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnh
    ydrwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaas
    mynndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkp
    legamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfpl
    gnnradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvr
    vrgaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlp
    davitit
    

    Sequence, based on observed residues (ATOM records):
    >2x2hC (C:)
    tdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsitv
    qhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtftse
    gfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygnai
    asvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpphh
    dgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqedla
    ymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqgvf
    gtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwtanr
    vgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsltg
    tdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvwqd
    mtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepmvt
    qrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsnyi
    qmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnhyd
    rwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaasmy
    nndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkple
    gamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfplgn
    nradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvrvr
    gaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlpda
    vitit
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2x2hD (D:)
    gstdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsi
    tvqhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtft
    segfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygn
    aiasvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpp
    hhdgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqed
    laymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqg
    vfgtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwta
    nrvgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsl
    tgtdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvw
    qdmtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepm
    vtqrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsn
    yiqmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnh
    ydrwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaas
    mynndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkp
    legamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfpl
    gnnradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvr
    vrgaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlp
    davitit
    

    Sequence, based on observed residues (ATOM records):
    >2x2hD (D:)
    tdnpdgidyktydyvgvwgfsplsntnwfaagsstpggitdwtatmnvnfdridnpsitv
    qhpvqvqvtsynnnsyrvrfnpdgpirdvtrgpilkqqldwirtqelsegcdpgmtftse
    gfltfetkdlsviiygnfktrvtrksdgkvimendevgtassgnkcrglmfvdrlygnai
    asvnknfrndavkqegfygagevnckyqdtyilertgiamtnynydnlnynqwdlrpphh
    dgalnpdyyipmyyaapwlivngcagtseqysygwfmdnvsqsymntgdttwnsgqedla
    ymgaqygpfdqhfvygagggmecvvtafsllqgkefenqvlnkrsvmppkyvfgffqgvf
    gtssllrahmpagennisveeivegyqnnnfpfeglavdvdmqdnlrvfttkgefwtanr
    vgtggdpnnrsvfewahdkglvcqtnitcflrndnegqdyevnqtlrerqlytkndsltg
    tdfgmtddgpsdayighldygggvecdalfpdwgrpdvaewwgnnykklfsigldfvwqd
    mtvpammphkigddinvkpdgnwpnaddpsngqynwktyhpqvlvtdmryenhgrepmvt
    qrnihaytlcestrkegivenadtltkfrrsyiisrggyignqhfggmwvgdnsttsnyi
    qmmianninmnmsclplvgsdiggftsydnenqrtpctgdlmvryvqagcllpwfrnhyd
    rwieskdhgkdyqelymypnemdtlrkfvefryrwqevlytamyqnaafgkpiikaasmy
    nndsnvrraqndhfllgghdgyrilcapvvwensterelylpvltqwykfgpdfdtkple
    gamnggdriynypvpqsespifvregailptrytlngenkslntytdedplvfevfplgn
    nradgmcylddggvttnaedngkfsvvkvaaeqdggtetitftndcyeyvfggpfyvrvr
    gaqspsnihvssgagsqdmkvssatsraalfndgengdfwvdqetdslwlklpnvvlpda
    vitit