PDB entry 2x2g

View 2x2g on RCSB PDB site
Description: crystallographic binding studies with an engineered monomeric variant of triosephosphate isomerase
Class: isomerase
Keywords: fatty acid biosynthesis, gluconeogenesis, glycolysis, glycosome, isomerase, lipid synthesis
Deposited on 2010-01-13, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • engineered mutation (16)
      • engineered mutation (65-69)
      • engineered mutation (71-72)
      • engineered mutation (90)
      • engineered mutation (223)
    Domains in SCOPe 2.07: d2x2ga_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • engineered mutation (12)
      • engineered mutation (15-16)
      • engineered mutation (65-69)
      • engineered mutation (71-72)
      • engineered mutation (90)
      • engineered mutation (223)
    Domains in SCOPe 2.07: d2x2gb_
  • Heterogens: 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x2gA (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2gA (A:)
    skpqpiaaanwdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaaqna
    gnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacigetlqer
    esgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahalirswv
    sskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x2gB (B:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq