PDB entry 2x29

View 2x29 on RCSB PDB site
Description: crystal structure of human4-1bb ligand ectodomain
Deposited on 2010-01-12, released 2010-03-23
The last revision was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21976
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor ligand superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41273 (0-166)
      • engineered mutation (67)
      • engineered mutation (88)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2x29A (A:)
dpaglldlrqgmfaqlvaqnvllidgplswysdpglagvsltgglsykedtkelvvakag
vyyvffqmelrrvvagegsgsvslalhlmplrsaagaaalaltvdlppassearnsafgf
qgrllhlsagqrlgvhlhteararhawqltqgatvlglfrvtpeipa

    Sequence, based on observed residues (ATOM records):
    >2x29A (A:)
dpaglldlrqgmfaqlvaqnvllidgplswysdpglagvsltgglsykedtkelvvakag
vyyvffqmelrrvvagegsgsvslalhlmpaaalaltvdlpprnsafgfqgrllhlsagq
rlgvhlhteararhawqltqgatvlglfrvtpeipa