PDB entry 2x1z

View 2x1z on RCSB PDB site
Description: structure of peridinin-chlorophyll-protein reconstituted with chl-d
Deposited on 2010-01-09, released 2010-02-09
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: peridinin-chlorophyll a-binding protein, chloroplastic
    Species: Amphidinium carterae [TaxId:2961]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80484 (0-150)
      • conflict (87)
      • conflict (128)
  • Heterogens: PID, CL7, DGD, CL, NA, PEG, CD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >2x1zM (M:)
    adeigdaakklgdasyafakevdwnngiflqapgklqplealkaidkmivmgaaadpkll
    kaaaeahhkaigsvsgpngvtsradwdsvnaalgrviasvpenmvmdvydsvskitdpkv
    paymkslvngadaekayegflafkdvvkksq