PDB entry 2x1x

View 2x1x on RCSB PDB site
Description: crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2 in a tetragonal crystal form
Class: hormone/signaling protein
Keywords: hormone-signaling protein complex, angiogenesis, glycoprotein, host-virus interaction, receptor, lymphangiogenesis, immunoglobulin domain, developmental protein, mitogen
Deposited on 2010-01-08, released 2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: vascular endothelial growth factor c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49767 (Start-103)
      • engineered mutation (25)
    • PDB 2X1X
    Domains in SCOPe 2.08: d2x1xe_
  • Chain 'R':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (Start-206)
    • PDB 2X1X
  • Heterogens: HG, NAG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2x1xE (E:)
    ahynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnsegl
    qcmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1xE (E:)
    hynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglq
    cmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmskl
    

  • Chain 'R':
    No sequence available.