PDB entry 2x1x
View 2x1x on RCSB PDB site
Description: crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2 in a tetragonal crystal form
Class: hormone/signaling protein
Keywords: hormone-signaling protein complex, angiogenesis, glycoprotein, host-virus interaction, receptor, lymphangiogenesis, immunoglobulin domain, developmental protein, mitogen
Deposited on
2010-01-08, released
2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-06-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.18
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: vascular endothelial growth factor c
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P49767 (Start-103)
- PDB 2X1X
Domains in SCOPe 2.08: d2x1xe_ - Chain 'R':
Compound: Vascular endothelial growth factor receptor 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P35968 (Start-206)
- PDB 2X1X
- Heterogens: HG, NAG, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence, based on SEQRES records: (download)
>2x1xE (E:)
ahynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnsegl
qcmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmsklhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2x1xE (E:)
hynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglq
cmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmskl
- Chain 'R':
No sequence available.