PDB entry 2x1w

View 2x1w on RCSB PDB site
Description: Crystal Structure of VEGF-C in Complex with Domains 2 and 3 of VEGFR2
Class: hormone/signaling protein
Keywords: hormone-signaling protein complex, angiogenesis, glycoprotein, host-virus interaction, membrane, receptor, lymphangiogenesis, immunoglobulin domain, developmental protein, transmembrane, phosphoprotein, disulfide bond, mitogen
Deposited on 2010-01-08, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2297
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular endothelial growth factor c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49767
      • engineered mutation (25)
    • PDB 2X1W
    Domains in SCOPe 2.07: d2x1wa_
  • Chain 'B':
    Compound: vascular endothelial growth factor c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49767
      • engineered mutation (25)
    • PDB 2X1W
    Domains in SCOPe 2.07: d2x1wb_
  • Chain 'C':
    Compound: vascular endothelial growth factor c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49767 (Start-103)
      • engineered mutation (25)
    • PDB 2X1W
    Domains in SCOPe 2.07: d2x1wc_
  • Chain 'D':
    Compound: vascular endothelial growth factor c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49767 (Start-103)
      • engineered mutation (25)
    • PDB 2X1W
    Domains in SCOPe 2.07: d2x1wd_
  • Chain 'L':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (Start-206)
    • PDB 2X1W
  • Chain 'M':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (Start-206)
    • PDB 2X1W
  • Chain 'N':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (Start-206)
    • PDB 2X1W
  • Chain 'O':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CS, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1wA (A:)
    ahynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnsegl
    qcmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1wA (A:)
    teilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmn
    tstsylsktlfeitvplsqgpkpvtisfanhtscrcms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x1wB (B:)
    ahynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnsegl
    qcmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1wB (B:)
    eilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmnt
    stsylsktlfeitvplsqgpkpvtisfanhtscrcmsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x1wC (C:)
    ahynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnsegl
    qcmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1wC (C:)
    lksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmntst
    sylsktlfeitvplsqgpkpvtisfanhtscrcmskl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x1wD (D:)
    ahynteilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnsegl
    qcmntstsylsktlfeitvplsqgpkpvtisfanhtscrcmsklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1wD (D:)
    eilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmnt
    stsylsktlfeitvplsqgpkpvtisfanhtscrcmskl
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.