PDB entry 2x1p

View 2x1p on RCSB PDB site
Description: gelsolin nanobody
Class: contractile protein
Keywords: contractile protein
Deposited on 2010-01-03, released 2011-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.204
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1P
  • Chain 'B':
    Compound: gelsolin nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1P
  • Chain 'C':
    Compound: gelsolin nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1P
  • Chain 'D':
    Compound: gelsolin nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1P
    Domains in SCOPe 2.01: d2x1pd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x1pD (D:)
    qvqlqesggglvqaggslrlscaasgrtftsfamgwfrqapgkerefvasisrsgtltry
    adsakgrftisvdnakntvslqmdnlnpddtavyycaadlhrpygpgtqrsdeydswgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1pD (D:)
    qlqesggglvqaggslrlscaasfamgwfrqapgkerefvasisrsgtltryadsakgrf
    tisvdnakntvslqmdnlnpddtavyycaadlhrpygpgtqrsdeydswgqgtqvtvs