PDB entry 2x1m

View 2x1m on RCSB PDB site
Description: crystal structure of mycobacterium smegmatis methionyl-tRNA synthetase in complex with methionine
Class: ligase
Keywords: nucleotide-binding, protein biosynthesis, ligase, aminoacyl-tRNA synthetase
Deposited on 2009-12-31, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x1ma1, d2x1ma2
  • Heterogens: MET, 2HP, CXS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1mA (A:)
    mahhhhhhggsepfyittaiaypngvphighayeyiatdaiarfkrldgydvryltgtdv
    hgqkmaetaakegipaaelarrnsdvfqrlqeklnisfdrfirtsdadhyeaskaiwkrm
    adagdiyldaykgwysirderfftenetteqpdgtriatetgapvtwteeqtyffrlsay
    tdrllalyeehpefigpdarrneivsfvsgglkdlsisrttfdwgvpvpdhpdhvmyvwv
    daltnyltgvgfpdtesesfrrywpadlhmigkdiirfhtvywpaflmsaglplpkrifa
    hgwllnrgekmsksignvvdpvnlvdtfgldqvryfllrevpfgqdgsynedaiigrvna
    dlanelgnlaqrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhl
    aleaiwsvlgaanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpe
    staklldllgqptderdfsaianrikpgtslpapsgifpryqnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1mA (A:)
    sepfyittaiaypngvphighayeyiatdaiarfkrldgydvryltgtdvhgqkmaetaa
    kegipaaelarrnsdvfqrlqeklnisfdrfirtsdadhyeaskaiwkrmadagdiylda
    ykgwysirderfftenetteqpdgtriatetgapvtwteeqtyffrlsaytdrllalyee
    hpefigpdarrneivsfvsgglkdlsisrttfdwgvpvpdhpdhvmyvwvdaltnyltgv
    gfpdtesesfrrywpadlhmigkdiirfhtvywpaflmsaglplpkrifahgwllnrgek
    msksignvvdpvnlvdtfgldqvryfllrevpfgqdgsynedaiigrvnadlanelgnla
    qrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhlaleaiwsvlg
    aanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpestaklldllg
    qptderdfsaianrikpgtslpapsgifpry