PDB entry 2x1k

View 2x1k on RCSB PDB site
Description: h71s mutant of the antibiotic resistance protein nima from deinococcus radiodurans
Class: oxidoreductase
Keywords: antibiotic resistance, oxidoreductase
Deposited on 2010-01-07, released 2010-11-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.1839
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nima-related protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RW27 (22-215)
      • expression tag (1-11)
      • expression tag (21)
      • engineered mutation (91)
    Domains in SCOPe 2.02: d2x1ka_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1kA (A:)
    msyyhhhhhhlestslykkaglsdfydprerdpsvsrrpqnrqsdewirelllrgtiarv
    atlwqgedgaafpfitplayayrpeqgdlvystnvvgrlranagqghpatlevseigqfl
    psnsplelsvqyrsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkr
    tsvyslsidrwsgkenwaeqaiqeedwpalgpewlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1kA (A:)
    syyhhhhhhlelsdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedga
    afpfitplayayrpeqgdlvystnvvgrlranagqghpatlevseigqflpsnsplelsv
    qyrsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidr
    wsgkenwaeqaiqeedwpalgpewlg