PDB entry 2x1i

View 2x1i on RCSB PDB site
Description: glycoside hydrolase family 77 4-alpha-glucanotransferase from thermus brockianus
Class: transferase
Keywords: transferase
Deposited on 2009-12-28, released 2010-10-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: THERMUS BROCKIANUS [TaxId:56956]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2x1ia_
  • Heterogens: PO4, SO4, INS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1iA (A:)
    melpcayglllhptslpgpwgvgvlgeeargflrflkeagarywqvlplgptgygdspyq
    sfsafagnpylidlrplvdrgfvrledpgfpegrvdygllyawkwpalraafqgfrqkas
    peekedfarfqeeeawwlrdyalfmtlkshhgglpwnawplalrtreeralkeaeaslae
    eiafhaftqwlffrqwgalkeeaealgiafigdmpifvaedsaevwahpewfhldeegrp
    tvvagvppdyfsetgqrwgnplyrwevleeegfsfwiarlrkalelfhlvridhfrgfea
    yweipascptavegrwvkapgeklfariqeafgripilaedlgvitpevealrdrfglpg
    mkvlqfafdngmenpflphnypehgrvvvytgthdndttlgwyrtatpherdflkrylad
    wgitfreeaevpwalmrlgmasrarlavypvqdvlalgsearmnypgrpsgnwawrlrpg
    eikeehgerllslaeatgrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1iA (A:)
    pcayglllhptslpgpwgvgvlgeeargflrflkeagarywqvlplgptgygdspyqsfs
    afagnpylidlrplvdrgfvrledpgfpegrvdygllyawkwpalraafqgfrqkaspee
    kedfarfqeeeawwlrdyalfmtlkshhgglpwnawplalrtreeralkeaeaslaeeia
    fhaftqwlffrqwgalkeeaealgiafigdmpifvaedsaevwahpewfhldeegrptvv
    agvppdyfsetgqrwgnplyrwevleeegfsfwiarlrkalelfhlvridhfrgfeaywe
    ipascptavegrwvkapgeklfariqeafgripilaedlgvitpevealrdrfglpgmkv
    lqfafdngmenpflphnypehgrvvvytgthdndttlgwyrtatpherdflkryladwgi
    tfreeaevpwalmrlgmasrarlavypvqdvlalgsearmnypgrpsgnwawrlrpgeik
    eehgerllslaeatgrv