PDB entry 2x19

View 2x19 on RCSB PDB site
Description: crystal structure of importin13 - rangtp complex
Class: nuclear transport
Keywords: nuclear transport, protein transport
Deposited on 2009-12-23, released 2010-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein GSP1/CNR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32835 (0-171)
      • engineered mutation (63)
    Domains in SCOPe 2.05: d2x19a_
  • Chain 'B':
    Compound: importin-13
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x19A (A:)
    gevptfklvlvgdggtgkttfvkrhltgefekkyiatigvevhplsfytnfgeikfdvwd
    taglekfgglrdgyyinaqcaiimfdvtsrityknvpnwhrdlvrvcenipivlcgnkvd
    vkerkvkaktitfhrkknlqyydisaksnynfekpflwlarklagnpqlefv
    

  • Chain 'B':
    No sequence available.