PDB entry 2x17

View 2x17 on RCSB PDB site
Description: the x-ray structure of ferritin from pyrococcus furiosus loaded with ag(I)
Class: metal transport
Keywords: ferritin, nano-particles, metal transport
Deposited on 2009-12-22, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.26132
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x170_
  • Chain '1':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x171_
  • Chain '2':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x172_
  • Chain '3':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x173_
  • Chain '4':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x174_
  • Chain '5':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x175_
  • Chain '6':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x176_
  • Chain '7':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x177_
  • Chain '8':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x178_
  • Chain '9':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x179_
  • Chain 'G':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17g_
  • Chain 'H':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17h_
  • Chain 'I':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17i_
  • Chain 'J':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17j_
  • Chain 'K':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17k_
  • Chain 'L':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17l_
  • Chain 'M':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17m_
  • Chain 'N':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17n_
  • Chain 'O':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17o_
  • Chain 'P':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17p_
  • Chain 'Q':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17q_
  • Chain 'R':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17r_
  • Chain 'Y':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17y_
  • Chain 'Z':
    Compound: putative ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x17z_
  • Heterogens: AG, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >2x170 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x170 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2x171 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x171 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2x172 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x172 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >2x173 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x173 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2x174 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x174 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2x175 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x175 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2x176 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x176 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2x177 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x177 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2x178 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x178 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2x179 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x179 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2x17G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2x17H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2x17I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2x17J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2x17K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2x17L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2x17M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2x17N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllm
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2x17O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllm
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2x17P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllm
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2x17Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2x17R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmq
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2x17Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllm
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2x17Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x17Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqg