PDB entry 2x16

View 2x16 on RCSB PDB site
Description: Crystallographic binding studies with an engineered monomeric variant of triosephosphate isomerase
Class: isomerase
Keywords: pentose shunt, gluconeogenesis, lipid synthesis, substrate specificity, fatty acid biosynthesis, tim barrel, peroxisome, glycolysis, isomerase, glycosome
Deposited on 2009-12-21, released 2009-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.1844
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • engineered mutation (65-69)
      • engineered mutation (71-72)
      • engineered mutation (90)
      • engineered mutation (223)
    Domains in SCOPe 2.07: d2x16a_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • engineered mutation (12)
      • engineered mutation (15-16)
      • engineered mutation (65-69)
      • engineered mutation (71-72)
      • engineered mutation (90)
      • engineered mutation (223)
    Domains in SCOPe 2.07: d2x16b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x16A (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x16A (A:)
    skpqpiaaanslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaaqnagn
    adalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacigetlqeres
    grtavvvltqiaaiakklkkadwakvviayepvwaatpqqaqeahalirswvsskigadv
    agelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x16B (B:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x16B (B:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkatpqqaqeahali
    rswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq