PDB entry 2x15

View 2x15 on RCSB PDB site
Description: the catalytically active fully closed conformation of human phosphoglycerate kinase in complex with ADP and 1,3-bisphosphoglycerate
Class: transferase
Keywords: transition state analogue, hereditary hemolytic anemia, phosphoprotein, kinase, glycolysis, transferase, phosphoryl transfer, nucleotide-binding
Deposited on 2009-12-21, released 2011-02-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19488
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x15a_
  • Heterogens: MG, ADP, X15, 3PG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x15A (A:)
    slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlm
    shlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillen
    lrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnl
    pqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
    ftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
    tvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvk
    atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x15A (A:)
    lsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgkkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqkaggfl
    mkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftflkvln
    nmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatvasgipa
    gwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkatsrgcit
    iigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni