PDB entry 2x13

View 2x13 on RCSB PDB site
Description: the catalytically active fully closed conformation of human phosphoglycerate kinase in complex with ADP and 3phosphoglycerate
Class: transferase
Keywords: transition state analogue, hereditary hemolytic anemia, ATP-binding, kinase, glycolysis, transferase, disease mutation
Deposited on 2009-12-21, released 2010-12-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.18695
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2x13a_
  • Heterogens: MG, 3PG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x13A (A:)
    slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlm
    shlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillen
    lrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnl
    pqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
    ftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
    tvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvk
    atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x13A (A:)
    lsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgkkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqkaggfl
    mkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftflkvln
    nmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatvasgipa
    gwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkatsrgcit
    iigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni