PDB entry 2x0v

View 2x0v on RCSB PDB site
Description: structure of the p53 core domain mutant y220c bound to 4-(trifluoromethyl)benzene-1,2-diamine
Class: cell cycle
Keywords: cell cycle, host-virus interaction, transcription regulation, transcription factor, li-fraumeni drug discovery, surface crevice, tumor suppressor, protein stabilization, transcription, metal binding, cancer, apoptosis
Deposited on 2009-12-17, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1635
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d2x0va_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d2x0vb_
  • Heterogens: ZN, X0V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x0vA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0vA (A:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
    vvvpcpevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvcac
    pgrdrrteeenlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x0vB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0vB (B:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg
    trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh
    svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv
    cacpgrdrrteeenl