PDB entry 2x0s

View 2x0s on RCSB PDB site
Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
Class: transferase
Keywords: kinase, transferase, tropical parasite
Deposited on 2009-12-17, released 2009-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.1687
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate phosphate dikinase
    Species: TRYPANOSOMA BRUCEI [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x0sa1, d2x0sa2, d2x0sa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x0sA (A:)
    mvakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqete
    tipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmpgmmdtvlnlglnkvt
    vdawvrraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltas
    dlkelcdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgt
    avnvqamvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhsl
    slrwakahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlw
    llqcrngkrtihaavriaidmvneglisreeavlridpyqvdhlmhpnlepgaekankpi
    grglaaspgaavgqvvfdaesakewsgrgkkvimvrletspedlagmdaacgiltarggm
    tshaavvargmgkccvsgcgdmvirgksfklngsvfregdyitidgskgliyagklklrs
    pdlkgsfqtilqwcqemkrlgvrtnadtpadaakarsfgaegvglcrtehmffegsrinf
    iremiladsasgrkaaldkllpiqradfvgilramrglpvtirlldpplhefvphdaaaq
    felaqklgmpaekvrnrvnalhelnpmlghrgcrlgitypeiynmqvraiieaaiavsee
    gssvipeimvplvgkkeelslireevvktaeavitksgkrvhytvgtmievpraavtads
    iaqkadffsfgtndltqmgcgfsrddagpflrhygnlgiyaqdpfqsidqegigelvria
    vtkgrrvkpmlkmgicgehggdpatigfchkvgldyvscspfrvpvaivaaahasikdrr
    aamkarkgfaakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0sA (A:)
    vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
    ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmdtvlnlglnkvtvdawv
    rraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasdlkel
    cdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgtavnvq
    amvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhslslrwa
    kahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwllqcr
    ngkrtihaavriaidmvneglisreeavlridpyqvdhlmhpnlepgaekankpigrgla
    aspgaavgqvvfdaesakewsgrgkkvimvrletspedlagmdaacgiltarggmtshaa
    vvargmgkccvsgcgdmvirgksfklngsvfregdyitidgskgliyagklklrspdlkg
    sfqtilqwcqemkrlgvrtnadtpadaakarsfgaegvglcrtehmffegsrinfiremi
    ladsasgrkaaldkllpiqradfvgilramrglpvtirlldpplhefvphdaaaqfelaq
    klgmpaekvrnrvnalhelnpmlghrgcrlgitypeiynmqvraiieaaiavseegssvi
    peimvplvgkkeelslireevvktaeavitksgkrvhytvgtmievpraavtadsiaqka
    dffsfgtndltqmgcgfsrddagpflrhygnlgiyaqdpfqsidqegigelvriavtkgr
    rvkpmlkmgicgehggdpatigfchkvgldyvscspfrvpvaivaaahasikdrraamk