PDB entry 2x0n

View 2x0n on RCSB PDB site
Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
Class: oxidoreductase
Keywords: glycolysis, glycosome, oxidoreductase
Deposited on 2009-12-16, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.1533
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0na1, d2x0na2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0nb1, d2x0nb2
  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0no1, d2x0no2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0np1, d2x0np2
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0nq1, d2x0nq2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0nr1, d2x0nr2
  • Heterogens: SO4, NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x0nA (A:)
    mtikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfk
    hsvsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaa
    eghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvk
    egfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstq
    gkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsad
    fisdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0nA (A:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x0nB (B:)
    mtikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfk
    hsvsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaa
    eghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvk
    egfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstq
    gkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsad
    fisdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0nB (B:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2x0nO (O:)
    mtikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfk
    hsvsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaa
    eghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvk
    egfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstq
    gkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsad
    fisdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0nO (O:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2x0nP (P:)
    mtikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfk
    hsvsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaa
    eghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvk
    egfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstq
    gkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsad
    fisdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0nP (P:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2x0nQ (Q:)
    mtikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfk
    hsvsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaa
    eghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvk
    egfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstq
    gkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsad
    fisdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0nQ (Q:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2x0nR (R:)
    mtikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfk
    hsvsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaa
    eghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvk
    egfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstq
    gkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsad
    fisdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x0nR (R:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl