PDB entry 2x07

View 2x07 on RCSB PDB site
Description: cytochrome c peroxidase: engineered ascorbate binding site
Class: oxidoreductase
Keywords: oxidoreductase, metal-binding
Deposited on 2009-12-07, released 2010-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-292)
      • engineered mutation (34)
      • engineered mutation (182)
      • engineered mutation (189)
      • conflict (255)
    Domains in SCOPe 2.08: d2x07a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x07A (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeadnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lkrsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdrffkdfskafekllengitfpkdapspfifktleeqgl