PDB entry 2wzp

View 2wzp on RCSB PDB site
Description: structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Class: viral protein
Keywords: baseplate, viral protein
Deposited on 2009-12-01, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1794
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative receptor binding protein
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RNF7 (0-262)
    • PDB 2WZP (263-265)
  • Chain 'B':
    Compound: putative receptor binding protein
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RNF7 (0-262)
    • PDB 2WZP (263-265)
  • Chain 'C':
    Compound: putative receptor binding protein
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RNF7 (0-262)
    • PDB 2WZP (263-265)
  • Chain 'D':
    Compound: camelid vhh5
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-122)
    Domains in SCOPe 2.07: d2wzpd1, d2wzpd2
  • Chain 'E':
    Compound: camelid vhh5
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-122)
    Domains in SCOPe 2.07: d2wzpe1, d2wzpe2
  • Chain 'F':
    Compound: camelid vhh5
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-122)
    Domains in SCOPe 2.07: d2wzpf1, d2wzpf2
  • Chain 'G':
    Compound: putative receptor binding protein
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RNF7 (0-262)
    • PDB 2WZP (263-265)
  • Chain 'H':
    Compound: putative receptor binding protein
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RNF7 (0-262)
    • PDB 2WZP (263-265)
  • Chain 'I':
    Compound: putative receptor binding protein
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RNF7 (0-262)
    • PDB 2WZP (263-265)
  • Chain 'J':
    Compound: camelid vhh5
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-122)
    Domains in SCOPe 2.07: d2wzpj1, d2wzpj2
  • Chain 'K':
    Compound: camelid vhh5
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-122)
    Domains in SCOPe 2.07: d2wzpk1, d2wzpk2
  • Chain 'L':
    Compound: camelid vhh5
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-122)
    Domains in SCOPe 2.07: d2wzpl1, d2wzpl2
  • Chain 'P':
    Compound: lactococcal phage p2 orf15
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-325)
  • Chain 'Q':
    Compound: lactococcal phage p2 orf15
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (Start-325)
  • Chain 'R':
    Compound: lactococcal phage p2 orf16
    Species: LACTOCOCCUS PHAGE P2 [TaxId:254252]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WZP (0-374)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wzpD (D:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzpD (D:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wzpE (E:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzpE (E:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wzpF (F:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzpF (F:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2wzpJ (J:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzpJ (J:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2wzpK (K:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzpK (K:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2wzpL (L:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzpL (L:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.