PDB entry 2wzo

View 2wzo on RCSB PDB site
Description: the structure of the fyr domain
Deposited on 2009-12-01, released 2010-05-05
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming growth factor beta regulator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wzoA (A:)
grpvfpiglggltvyslgeiitdrpgfhdesaiypvgycstriyasmkcpdqkclytcqi
kdggvqpqfeivpeddpqnaivsssadachaellrtisttmgklmpnllpagadffgfsh
paihnliqscpgarkcinyqwvkfdv