PDB entry 2wzm

View 2wzm on RCSB PDB site
Description: crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2009-11-30, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.18029
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldo-keto reductase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wzma_
  • Chain 'B':
    Compound: aldo-keto reductase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wzmb_
  • Heterogens: NA7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wzmA (A:)
    mtashgqaaaiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygn
    eaavgraiaasgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpgg
    dtskyvdswgglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaa
    lrevnagynivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsa
    nperiasnldvfgfeltademetlnglddgtrfrpdpatytgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzmA (A:)
    aiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygneaavgraia
    asgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpggdtskyvdsw
    gglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaalrevnagyn
    ivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsanperiasnl
    dvfgfeltademetlnglddgtrfrpdpatytgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wzmB (B:)
    mtashgqaaaiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygn
    eaavgraiaasgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpgg
    dtskyvdswgglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaa
    lrevnagynivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsa
    nperiasnldvfgfeltademetlnglddgtrfrpdpatytgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzmB (B:)
    aiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygneaavgraia
    asgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpggdtskyvdsw
    gglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaalrevnagyn
    ivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsanperiasnl
    dvfgfeltademetlnglddgtrfrpdpatytgs