PDB entry 2wzd

View 2wzd on RCSB PDB site
Description: the catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with ADP, 3pg and aluminium trifluoride
Class: transferase
Keywords: transferase, hereditary hemolytic anemia, phosphoprotein, kinase, glycolysis, nucleotide-binding
Deposited on 2009-11-27, released 2010-04-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.16815
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00558 (Start-416)
      • engineered mutation (219)
    Domains in SCOPe 2.01: d2wzda_
  • Heterogens: MG, CL, AF3, ADP, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wzdA (A:)
    mslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
    mshlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsville
    nlrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvn
    lpqkaggflmkkelnyfakalesperpflailggakvadaiqlinnmldkvnemiigggm
    aftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
    atvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevv
    katsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzdA (A:)
    lsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgepakieafraslsklgdvyvndafgtahrahssmvgvnlpqkaggflmkk
    elnyfakalesperpflailggakvadaiqlinnmldkvnemiigggmaftflkvlnnme
    igtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatvasgipagwm
    gldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkatsrgcitiig
    ggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni