PDB entry 2wzb

View 2wzb on RCSB PDB site
Description: the catalytically active fully closed conformation of human phosphoglycerate kinase in complex with ADP, 3pg and magnesium trifluoride
Class: transferase
Keywords: hereditary hemolytic anemia, transferase, phosphoprotein, kinase, glycolysis, nucleotide-binding
Deposited on 2009-11-27, released 2010-04-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.16222
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2wzba_
  • Heterogens: MG, CL, ADP, 3PG, MGF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wzbA (A:)
    slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlm
    shlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillen
    lrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnl
    pqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
    ftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
    tvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvk
    atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wzbA (A:)
    lsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgepakieafraslsklgdvyvndafgtahrahssmvgvnlpqkaggflmkk
    elnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftflkvlnnme
    igtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatvasgipagwm
    gldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkatsrgcitiig
    ggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni