PDB entry 2wyz

View 2wyz on RCSB PDB site
Description: L38V SOD1 mutant complexed with UMP
Class: oxidoreductase
Keywords: oxidoreductase, disease mutation, amyotrophic lateral sclerosis, antioxidant
Deposited on 2009-11-20, released 2010-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (37)
    Domains in SCOPe 2.08: d2wyza_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (37)
    Domains in SCOPe 2.08: d2wyzf_
  • Heterogens: ZN, CU, SO4, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyzA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikgvteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyzF (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikgvteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq