PDB entry 2wyx

View 2wyx on RCSB PDB site
Description: neutron structure of a class a beta-lactamase toho-1 e166a r274n r276n triple mutant
Class: hydrolase
Keywords: toho-1, hydrolase, beta-lactamase, ctx- m-type esbls, neutron structure, antibiotic resistance, extended-spectrum beta-lactamases (esbls)
Deposited on 2009-11-20, released 2010-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: NEUT
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactamse toho-1
  Species: ESCHERICHIA COLI [TaxId:511693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47066 (0-255)
    • engineered mutation (136)
    • engineered mutation (242)
    • engineered mutation (244)
  Domains in SCOPe 2.01: d2wyxa_
• Heterogens: DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wyxA (A:)
  vqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdkh
  llnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkvt
  afarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlvt
  wlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeqk
  aenrndilaaaakivt