PDB entry 2wyw

View 2wyw on RCSB PDB site
Description: High resolution structure of Thermus thermophilus enoyl-acyl carrier protein reductase NAD and triclosan-form
Class: oxidoreductase
Keywords: oxidoreductase, fatty acid biosynthesis, oxidation reduction
Deposited on 2009-11-20, released 2010-11-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1565
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wywa_
  • Chain 'B':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wywb_
  • Chain 'C':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wywc_
  • Chain 'D':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wywd_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wywA (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wywA (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wywB (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wywB (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgme
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wywC (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wywC (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wywD (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wywD (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgme