PDB entry 2wyu

View 2wyu on RCSB PDB site
Description: High resolution structure of Thermus thermophilus enoyl-acyl carrier protein reductase apo-form
Class: oxidoreductase
Keywords: oxidoreductase, fatty acid biosynthesis, oxidation reduction
Deposited on 2009-11-20, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17037
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyua_
  • Chain 'B':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyub_
  • Chain 'C':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyuc_
  • Chain 'D':
    Compound: enoyl-[acyl carrier protein] reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyud_
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wyuA (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wyuA (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wyuB (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wyuB (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrftkmydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvd
    agyhimgmel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wyuC (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wyuC (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wyuD (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wyuD (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhi
    mgmel