PDB entry 2wyt

View 2wyt on RCSB PDB site
Description: 1.0 A resolution structure of L38V SOD1 mutant
Class: oxidoreductase
Keywords: oxidoreductase, disease mutation, amyotrophic lateral sclerosis, antioxidant
Deposited on 2009-11-20, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d2wyta_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d2wytf_
  • Heterogens: CU, ZN, SO4, ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wytA (A:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikgvteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wytF (F:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikgvteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq