PDB entry 2wyq

View 2wyq on RCSB PDB site
Description: the crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Class: DNA binding protein
Keywords: DNA binding protein, DNA excision repair, proteasomal degradation, polyubiquitin
Deposited on 2009-11-19, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.126
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uv excision repair protein rad23 homolog a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyqa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wyqA (A:)
    gipmavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsd
    dvpirdyrideknfvvvmvtktkag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wyqA (A:)
    mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
    irdyrideknfvvvmvt